Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productdna-binding protein hu homolog hupb (histone-like protein) (hlp) (21-kda laminin-2-binding protein)
CommentsMb3010c, hupB, len: 214 aa. Equivalent to Rv2986c,len: 214 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 214 aa overlap). Probable hupB (alternate gene names: hup, hlp, lbp21), DNA-binding protein HU homolog (resembles fusion between HU and histone) (see first citation below), equivalent to others from Mycobacteria e.g. Q9XB18|DBH_MYCBO from Mycobacterium bovis (205 aa), FASTA scores: opt: 1050, E(): 5.6e-45,(95.35% identity in 214 aa overlap); Q9ZHC5|DBH_MYCSM from Mycobacterium smegmatis (208 aa), FASTA scores: opt: 1035,E(): 3.1e-44, (80.2% identity in 217 aa overlap); and O33125|DBH_MYCLE from Mycobacterium leprae (200 aa), FASTA scores: opt: 914, E(): 2.7e-38, (80.1% identity in 216 aa overlap). Also highly similar to others from other organisms e.g. O86537|DBH2_STRCO from Streptomyces coelicolor (218 aa), FASTA scores: opt: 569, E(): 2.6e-21,(51.35% identity in 220 aa overlap); P08821|DBH1_BACSU from Bacillus subtilis (92 aa), FASTA scores: opt: 280,E(): 2.5e-07, (45.05% identity in 91 aa overlap) (C-terminus shorter); etc. Contains PS00045 Bacterial histone-like DNA-binding proteins signature. BELONGS TO THE BACTERIAL HISTONE-LIKE PROTEIN FAMILY. Note that its C-terminal domain is very rich in lysine and alanine.
Functional category-
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS32997363300380-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3010c|hupB
MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGPAVKRGVGASAAKKVAKKAPAKKATKAAKKAATKAPARKAATKAPAKKAATKAPAKKAVKATKSPAKKVTKAVKKTAVKASVRKAATKAPAKKAAAKRPATKAPAKKATARRGRK
      
Bibliography
No article yet recorded