Gene Mb3155
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3155, -, len: 332 aa. Equivalent to Rv3131, len: 332 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 332 aa overlap). Hypothetical protein,similar to other hypothetical bacterial proteins e.g. O53476|Rv2032|MTV018.19 (331 aa), FASTA scores: opt: 568,E(): 2.5e-27, (36.7% identity in 321 aa overlap); O05800|Rv3127|MTCY164.37 (344 aa), FASTA scores: opt: 521,E(): 1.9e-24, (34.95% identity in 326 aa overlap); Q9RI33|SCJ12.27c from Streptomyces coelicolor (335 aa),FASTA scores: opt: 441, E(): 1.3e-19, (35.75% identity in 319 aa overlap); Q9RI44|SCJ12.14 from Streptomyces coelicolor (309 aa), FASTA scores: opt: 328, E(): 9.3e-13,(27.9% identity in 308 aa overlap); Q9CBP5|ML1751 from Mycobacterium leprae (721 aa), FASTA scores: opt: 137,E(): 0.78, (26.15% identity in 298 aa overlap); etc. Equivalent to AAK47555 from Mycobacterium tuberculosis strain CDC1551 but shorter 12 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3450323 | 3451321 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3155|Mb3155
MNTHFPDAETVRTVLTLAVRAPSIHNTQPWRWRVCPTSLELFSRPDMQLRSTDPDGRELILSCGVALHHCVVALASLGWQAKVNRFPDPKDRCHLATIGVQPLVPDQADVALAAAIPRRRTDRRAYSCWPVPGGDIALMAARAARGGVMLRQVSALDRMKAIVAQAVLDHVTDEEYLRELTIWSGRYGSVAGVPARNEPPSDPSAPIPGRLFAGPGLSQPSDVLPADDGAAILALGTETDDRLARLRAGEAASIVLLTATAMGLACCPITEPLEIAKTRDAVRAEVFGAGGYPQMLLRVGWAPINADPLPPTPRRELSQVVEWPEELLRQRC
Bibliography
No article yet recorded
