Gene Mb3161
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE MONOPHOSPHATASE |
| Comments | Mb3161, -, len: 260 aa. Equivalent to Rv3137, len: 260 aa, from Mycobacterium tuberculosis strain H37Rv,(99.6% identity in 260 aa overlap). Probable monophosphatase (EC 3.1.3.-), equivalent to O32889|MLCB1779_19|ML0662 PUTATIVE MONOPHOSPHATASE from Mycobacterium leprae (255 aa), FASTA scores: opt: 1403,E(): 1.2e-81, (81.8% identity in 253 aa overlap). Also similar to Q9K4B1|SC7E4.05c from Streptomyces coelicolor (266 aa), FASTA scores: opt: 969, E(): 3.5e-54, (57.9% identity in 259 aa overlap); Q53743|PUR3 MONO-PHOSPHATASE from Streptomyces lipmanii (Streptomyces alboniger) (273 aa), FASTA scores: opt: 862, E(): 2.1e-47, (55.25% identity in 257 aa overlap); BAB50023|MLL3039 MONO-PHOSPHATASE from Rhizobium loti (Mesorhizobium loti) (262 aa), FASTA scores: opt: 448, E(): 3.2e-21, (31.37% identity in 255 aa overlap); etc. Contains inositol monophosphatase family signature 1 (PS00629). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3458502 | 3459284 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3161|Mb3161
MSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESDVRQTLGRDRPGDGVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWASLIALLEDGVPSVGVVSAPALQRRWWAARGRGAFASVDGARPHRLSVSSVAELHSASLSFSSLSGWARLGLRERFIGLTDTVWRVRAYGDFLSYCLVAEGAVDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHGGSAVATNGLLHDEVLTRLNAG
Bibliography
No article yet recorded