Gene Mb3183c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ppe family protein ppe53 |
| Comments | Mb3183c, PPE53, len: 589 aa. Equivalent to Rv3159c,len: 590 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 590 aa overlap). Member of the Mycobacterium tuberculosis PPE_family of Gly-, Asn-rich proteins. Highly similar to P71868|Rv3533c|MTCY03C7.23 (582 aa), FASTA scores: opt: 2289, E(): 3.2e-98, (63.5% identity in 600 aa overlap); and also similar to MTCY48_17, MTV041_29, MTCY6G11_5, MTCY98_24, etc. TBparse score is 0.921. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, albeit a 2143 bp insertion occurs overlapping the NH2-terminal part, this leads to an equivalent product, compared to its homolog in Mycobacterium tuberculosis strain H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3482500 | 3484269 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3183c|PPE53
MNYSVLPPEINSLRMFTGAGSAPMLAASVAWDRLAAELAVAASSFGSVTSGLAGQSWQGAAAAMAAAAAPYAGWLAAAAARAAGASAQAKAVASAFEAARAATVHPMLVAANRNAFVQLVLSNLFGQNAPAIAAAEAMYEQMWAADVAAMVGYHGGASAAAAQLSSWSIGLQQALPAAPSALAAAIGLGNIGVGNLGGGNTGEYNLGSGNSGNANVGSGNSGNANVGSGNDGATNLGSGNIGNTNLGSGNVGNVNLGSGNRGFGNLGNGNFGSGNLGSGNTGSTNFGGGNLGSFNLGSGNIGSSNIGFGNNGDNNLGLGNNGNNNIGFGLTGDNLVGIGALNSGIGNLGFGNSGNNNIGFFNSGNNNVGFFNSGNNNFGFGNAGDINTGFGNAGDTNTGFGNAGFFNMGIGNAGNEDMGVGNGGSFNVGVGNAGNQSVGFGNAGTLNVGFANAGSINTGFANSGSINTGGFDSGDRNTGFGSSVDQSVSSSGFGNTGMNSSGFFNTGNVSAGYGNNGDVQSGINNTNSGGFNVGFYNSGAGTVGIANSGLQTTGIANSGTLNTGVANTGDHSSGGFNQGSDQSGFFGQP
Bibliography
No article yet recorded
