Gene Mb3194
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3194, -, len: 374 aa. Equivalent to Rv3169, len: 374 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 374 aa overlap). Conserved hypothetical protein, with similarity to other hypothetical proteins: Q9A8W6|CC1232 from Caulobacter crescentus (368 aa), FASTA scores: opt: 669, E(): 3.3e-34,(34.05% identity in 376 aa overlap); and O32901|MLCB1779.41 from Mycobacterium leprae (127 aa),FASTA scores: opt: 179, E(): 0.00034, (29.0% identity in 131 aa overlap). Also weak similarity with P95149|Rv1866|MTCY359.07c (804 aa), FASTA scores: opt: 121, E(): 6.4, (37.0% identity in 119 aa overlap). Equivalent to AAK47597 from Mycobacterium tuberculosis strain CDC1551 but shorter 43 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3494489 | 3495613 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3194|Mb3194
MPQMLGPLDEYPLHQLPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFLITGIGYYPNLGVKDAFVLIRRADIQTAVHLSDAIDSDRLHQHVNGYRVEVVEPLRKLRIVLDETEGVAADLTWEGLFDVVQEQPHVLRSGNRVTLDAQRFAQLGTWSGRIVVDGERIAVDPATWLGSRDRSWGIRPVGEPEPAGRPADPPFEGMWWLYVPLAFDDFAVVLIIQEEPDGFRSLNDCTRIWRDGHVEQLGWPRVRIHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWSHGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVGRALCRDGDGNPVQGWGLFEHGALGRHDPSGFADWSTLAP
Bibliography
No article yet recorded