Gene Mb3207c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3207c, -, len: 150 aa. Equivalent to Rv3181c,len: 150 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 150 aa overlap). Hypothetical protein,with some similarity to other mycobacterium proteins e.g. Q50718|YY07_MYCTU|Rv3407|MT3515|MTCY78.21c (99 aa), FASTA scores: opt: 123, E(): 0.25, (33.7% identity in 89 aa overlap); and O50412|Rv3385c|MTV004.43c (102 aa), FASTA scores: opt: 123, E(): 0.26, (39.7% identity in 68 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3506941 | 3507393 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3207c|Mb3207c
MQLGRKVTSHHDIDRFGVASTADESVYRPLPPRLRLAQVNLSRRRCRTQSDMYKSRFSECTVQSVDVSVTELRAHLSDWLDRARAGGEVVITERGIPIARLAALDSTDTLERLTAEGVIGKATAQRPVAAGRPRPRPQRPVSDRVSDQRR
Bibliography
No article yet recorded