Gene Mb3207c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | conserved protein | 
| Comments | Mb3207c, -, len: 150 aa. Equivalent to Rv3181c,len: 150 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 150 aa overlap). Hypothetical protein,with some similarity to other mycobacterium proteins e.g. Q50718|YY07_MYCTU|Rv3407|MT3515|MTCY78.21c (99 aa), FASTA scores: opt: 123, E(): 0.25, (33.7% identity in 89 aa overlap); and O50412|Rv3385c|MTV004.43c (102 aa), FASTA scores: opt: 123, E(): 0.26, (39.7% identity in 68 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3506941 | 3507393 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb3207c|Mb3207c
MQLGRKVTSHHDIDRFGVASTADESVYRPLPPRLRLAQVNLSRRRCRTQSDMYKSRFSECTVQSVDVSVTELRAHLSDWLDRARAGGEVVITERGIPIARLAALDSTDTLERLTAEGVIGKATAQRPVAAGRPRPRPQRPVSDRVSDQRR
      
    Bibliography
    No article yet recorded