Gene Mb3210
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3210, -, len: 115 aa. Equivalent to Rv3188, len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 115 aa overlap). Conserved hypothetical protein, with similarity to other proteins from Mycobacterium tuberculosis: Q10868|YJ90_MYCTU|Rv1990c|MT2044|MTCY39.29 HYPOTHETICAL PROTEIN (113 aa), FASTA scores: opt: 184, E(): 8.1e-06,(28.45% identity in 109 aa overlap); and O06299|Rv0348|MTCY13E10.08 HYPOTHETICAL PROTEIN (217 aa),FASTA scores: opt: 129, E(): 0.074, (30.0% identity in 100 aa overlap). Also some similarity with C-terminus of Q9XA59|SCGD3.19 PUTATIVE TWO-COMPONENT SYSTEM RESPONSE TRANSCRIPTIONAL REGULATOR from Streptomyces coelicolor (218 aa), FASTA scores: opt: 114, E(): 0.76, (30.0% identity in 110 aa overlap) (for this one, no similarity exists in the N-terminal region with the N-terminus of other regulatory components of sensory transduction systems). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3508832 | 3509179 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3210|Mb3210
MAVTLDRAVEASEIVDALKPFGVTQVDVAAVIQVSDRAVRGWRTGDIRPERYDRLAQLRDLVLLLSDSLTPRGVGQWLHAKNRLLDGQRPVDLLAKDRYEDVRSAAESFIDGAYV
Bibliography
No article yet recorded