Gene Mb3242
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | gcn5-related n-acetyltransferase, pseudogene |
| Comments | Mb3242, -, len: 110 aa. Equivalent to Rv3216, len: 110 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 110 aa overlap). Possible acetyltransferase (2.3.1.-), similar but shorter to many e.g. Q9AB32|CC0402 ACETYLTRANSFERASE (GNAT FAMILY) from Caulobacter crescentus (159 aa), FASTA scores: opt: 325,E(): 3.8e-17, (45.65% identity in 103 aa overlap); P79081|ATS1 PUTATIVE ACETYLTRANSFERASE ATS1 from Schizosaccharomyces pombe (Fission yeast) (168 aa), FASTA scores: opt: 313, E(): 3.1e-16, (47.6% identity in 105 aa overlap); Q9I640|PA0478 PROBABLE N-ACETYLTRANSFERASE from Pseudomonas aeruginosa (158 aa), FASTA scores: opt: 308,E(): 6.9e-16, (50.0% identity in 98 aa overlap); Q9KHE3 PUTATIVE ACETYLTRANSFERASE from Anabaena sp. strain PCC 7120 (164 aa), FASTA scores: opt: 269, E(): 5.4e-13,(41.75% identity in 103 aa overlap); etc. Also some similarity to diamine acetyltransferases (EC 2.3.1.57) e.g. Q28999|ATDA_PIG|SAT from Sus scrofa (Pig) (171 aa),FASTA scores: opt: 152, E(): 0.00025, (23.15% identity in 108 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3548063 | 3548395 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3242|Mb3242
MRGHVAEVNGGVAAMALWFLNFSTWDGVAGIYVEDLFVWPRFRRRGLARGLLSTLARECVDNRYTRLAWSVLNWNSDAIALYDRIGGQPQHEWTIYRLSGPRLAALAAPR
Bibliography
No article yet recorded
