Gene Rv3216
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Acetylation, substrate unknown |
| Product | GCN5-related N-acetyltransferase, pseudogene |
| Comments | Rv3216, (MTCY07D11.10c), len: 160 aa. Acetyltransferase (2.3.1.-), contains GNAT domain (Gcn5-related N-acetyltransferase. See Vetting et al. 2005), probably pseudogene as appears frameshifted due to 1bp insertion at position 3593438. Frameshift present in all sequenced tubercle bacilli. Start changed since first submission, extended by 50aa. Similar to many acetyltransferases e.g. Q9AB32|CC0402 acetyltransferase (GNAT family) from Caulobacter crescentus (159 aa), FASTA scores: opt: 325, E(): 3.8e-17, (45.65% identity in 103 aa overlap); P79081|ATS1 putative acetyltransferase ATS1 from Schizosaccharomyces pombe (Fission yeast) (168 aa), FASTA scores: opt: 313, E(): 3.1e-16, (47.6% identity in 105 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3593369 | 3593852 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3216|Rv3216
VTDTIRRATPADTADIVAMIHALAEFEYAADQCTVTETQIHTALFGDFPTMRGHVAEVNGGVAAMALWFLNFSTWDGVAGIYVEDLFVWPRFRRRGLARGLLSTLARECVDNRYTRLAWSVLNWNSDAIALYDRIGGQPQHEWTIYRLSGPRLAALAAPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Vetting MW et al. [2005]. Structure and functions of the GNAT superfamily of acetyltransferases. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
