Gene Mb3275c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | thymidylate kinase tmk (dtmp kinase) (thymidylic acid kinase) (tmpk) |
| Comments | Mb3275c, tmk, len: 214 aa. Equivalent to Rv3247c,len: 214 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 214 aa overlap). Probable tmk,thymidylate kinase (EC 2.7.4.9), equivalent to Q9CCJ3|TMK|ML0772 PUTATIVE THYMIDYLATE KINASE from Mycobacterium leprae (210 aa), FASTA scores: opt: 1023,E(): 4.8e-57, (77.3% identity in 207 aa overlap). Also similar to other thymidylate kinases e.g. Q9RQJ9|KTHY_CAUCR|TMK|CC1824 from Caulobacter crescentus (208 aa), FASTA scores: opt: 179, E(): 0.0003, (31.3% identity in 214 aa overlap); Q9V1E9|KTHY_PYRAB|TMK|PAB0319 from Pyrococcus abyssi (205 aa), FASTA scores: opt: 176,E(): 0.00045, (29.1% identity in 189 aa overlap); etc. BELONGS TO THE THYMIDYLATE KINASE FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3582019 | 3582663 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3275c|tmk
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Bibliography
No article yet recorded
