Gene Mb3306c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | Mb3306c, -, len: 172 aa. Equivalent to Rv3278c,len: 172 aa, from Mycobacterium tuberculosis strain H37Rv,(99.4% identity in 172 aa overlap). Probable conserved transmembrane protein, equivalent to Q9CCL2|ML0733 PUTATIVE MEMBRANE PROTEIN from Mycobacterium leprae (172 aa), FASTA scores: opt: 1024, E(): 6e-61, (83.15% identity in 172 aa overlap); and Q49672|B1308_F2_67 HYPOTHETICAL PROTEIN from Mycobacterium leprae (181 aa), FASTA scores: opt: 1024, E(): 6.3e-61, (83.15% identity in 172 aa overlap) (this is certainly the same putative protein but with N-terminus longer). Also some similarity to other hypothetical proteins (generally membrane proteins) e.g. O26822|MTH726 HYPOTHETICAL PROTEIN from Methanobacterium thermoautotrophicum (204 aa), FASTA scores: opt: 147, E(): 0.0079, (24.6% identity in 187 aa overlap); Q9X8H4|SCE9.01 HYPOTHETICAL 47.7 KDA PROTEIN (FRAGMENT) from Streptomyces coelicolor (436 aa), FASTA scores: opt: 151, E(): 0.0079,(28.1% identity in 153 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3615239 | 3615757 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3306c|Mb3306c
MSYPENVLAAGEQVVLHRHPHWNRLIWPVVVLVLLTGLAAFGSGFVNSTPWQQIAKNVIHAVIWGIWLVIVGWLTLWPFLSWLTTHFVVTNRRVMFRHGVLTRSGIDIPLARINSVEFRDRIFERIFRTGTLIIESASQDPLEFYNIPRLREVHALLYHKVFDTLGSDESPS
Bibliography
No article yet recorded