Gene Mb3314c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | alternative rna polymerase sigma factor sigf |
| Comments | Mb3314c, sigF, len: 261 aa. Equivalent to Rv3286c,len: 261 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 261 aa overlap). Probable sigF, stress response/stationary phase RNA polymerase sigma factor (see citations below), similar to several Streptomyces RNA polymerase sigma factors e.g. Q9RPC8|SIGH from Streptomyces coelicolor A3(2) (354 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9RIT0|SIG1 from Streptomyces coelicolor (361 aa), FASTA scores: opt: 869, E(): 1.1e-45, (51.15% identity in 258 aa overlap); Q9ADM4|2SC10A7.38c from Streptomyces coelicolor (318 aa), FASTA scores: opt: 776, E(): 4.6e-40, (48.75% identity in 240 aa overlap); P37971|RPOF_STRCO|SIGF|RPOX|2SCD60.01c from Streptomyces coelicolor (287 aa), FASTA scores: opt: 717, E(): 1.6e-36,(44.5% identity in 245 aa overlap); P37970|RPOF_STRAU|SIGF|RPOX from Streptomyces aureofaciens (297 aa); etc. Contains possible helix-turn-helix motif at aa 229-250 (+7.38 SD). SIMILAR TO THE SIGMA-70 FACTOR FAMILY. Seems expressed in stationary phase and under stress conditions in vitro (see citations below). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3622694 | 3623479 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3314c|sigF
MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE
Bibliography
No article yet recorded