Gene Mb3350c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb44 |
Comments | Mb3350c, -, len: 80 aa. Equivalent to Rv3321c, len: 80 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 80 aa overlap). Conserved hypothetical protein, similar at N-terminal region to several proteins from Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. AAK48167|MT3800 DNA-BINDING PROTEIN (COPG FAMILY) from strain CDC1551 (74 aa), FASTA scores: opt: 142, E(): 0.0016, (48.85% identity in 43 aa overlap); AAK46916|MT2606 HYPOTHETICAL 8.0 KDA PROTEIN from strain CDC1551 (74 aa), FASTA scores: opt: 139, E(): 0.0026,(37.2% identity in 78 aa overlap); O50456|Rv1241|MTV006.13 HYPOTHETICAL 9.9 KDA PROTEIN from strain H37Rv (86 aa),FASTA scores: opt: 134, E(): 0.0066, (39.0% identity in 82 aa overlap); etc. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3662596 | 3662838 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3350c|vapb44 MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV
Bibliography
No article yet recorded