Gene Mb3386c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb3386c, -, len: 264 aa. Equivalent to Rv3351c,len: 264 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 264 aa overlap). Hypothetical protein,highly similar to C-terminal region (aa 292-479) of O53608|Rv0063|MTV030.06 OXIDOREDUCTASE from M. tuberculosis (479 aa), FASTA scores: opt: 699, E(): 1.7e-36, (54.75% identity in 190 aa overlap). Shows some similarity to Q9KYD6|SCD72A.20 PUTATIVE LIPOPROTEIN (FRAGMENT) from Streptomyces coelicolor (403 aa), FASTA scores: opt: 192, E(): 9.1e-05, (27.9% identity in 154 aa overlap); and P71091|YGAK HYPOTHETICAL 54.4 KDA PROTEIN from Bacillus subtilis (480 aa), FASTA scores: opt: 174,E(): 0.0014, (26.5% identity in 166 aa overlap). Note that the two upstream ORFs Rv3352c and Rv3353c also show similarity to Rv0063 (MTV030_7). Sequence was checked but no errors found. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3720872 | 3721666 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3386c|Mb3386c
MLASCPARSGAAVADAIKSAVGVQPSGVEHKTLRRMDLVRYLAGGHTTYPPEGFVAGSDVIGTTNPAAAQAIVAAIGTWPPAAGRASALIDSLGGAVGDMDPEGSAFPWCRQSAVVQWYVNTPSDGQVATANKWLSDAHHAVQHFSVGGYVNYLEANAAASQYFGANLSRLTTVRRKYDPDRIMYSGLDFSTRQVAERLLPALGFRVRFGVLVIRCALCTDTVKRLGTLPNLTWSRLKVNVAVTQEQAGVMDLPALPVRRTPRR
Bibliography
No article yet recorded