Gene Mb3392
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antitoxin relj |
| Comments | Mb3392, -, len: 91 aa. Equivalent to Rv3357, len: 91 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 91 aa overlap). Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9Z4V7|YU1E_STRCO (alias CAC37261|SCBAC17D6.02) ORFU1E (BELONGS TO THE PHD/YEFM FAMILY) from Streptomyces coelicolor (87 aa), FASTA scores: opt: 344, E(): 1.9e-17,(62.05% identity in 87 aa overlap); P46147|YEFM_ECOLI|B2017 from Escherichia coli strain K12 (83 aa), FASTA scores: opt: 215, E(): 1.6e-08, (50.0% identity in 72 aa overlap); BAB58570|SAV2408 from Staphylococcus aureus subsp. aureus Mu50 (83 aa), FASTA scores: opt: 161, E(): 8.8e-05, (39.95% identity in 77 aa overlap); Q9Z5W8 PUTATIVE PHD PROTEIN from Francisella novicid (85 aa), FASTA scores: opt: 143, E(): 0.0016,(28.9% identity in 83 aa overlap); etc. Also similar to Rv1247c|MTV006.19c (89 aa) (36.9% identity in 84 aa overlap). SEEMS TO BELONG TO THE PHD/YEFM FAMILY. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3724299 | 3724574 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3392|relj
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE
Bibliography
No article yet recorded
