Gene Mb3416c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible toxin vapc46. contains pin domain. |
| Comments | Mb3416c, -, len: 130 aa. Equivalent to Rv3384c,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Hypothetical protein,similar to Mycobacterium tuberculosis hypothetical proteins P95252|Rv1962c|MTCY09F9.02 (135 aa), FASTA scores: opt: 266, E(): 1.6e-10, (43.1% identity in 130 aa overlap); and Q50717|YY08_MYCTU|Rv3408|MTCY78.20c (136 aa), FASTA scores: opt: 243, E(): 4.8e-09, (35.1% identity in 131 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3751526 | 3751918 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3416c|vapc46
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAGGLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Bibliography
No article yet recorded