Gene Mb3422
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CONSERVED LIPOPROTEIN LPQD |
| Comments | Mb3422, lpqD, len: 236 aa. Equivalent to Rv3390,len: 236 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 236 aa overlap). Probable lpqD, a conserved lipoprotein with some similarity to various bacterial proteins e.g. Q9F3Q7|SC10F4.03 PUTATIVE ISOMERASE from Streptomyces coelicolor (224 aa), FASTA scores: opt: 416, E(): 2.5e-18, (33.0% identity in 197 aa overlap); Q9ZAX0|PGM 2,3-PDG DEPENDENT PHOSPHOGLYCERATE MUTASE from Amycolatopsis methanolica (205 aa), FASTA scores: opt: 314, E(): 3.7e-12, (28.55% identity in 203 aa overlap); P73454|SLR1748 HYPOTHETICAL 24.2 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (214 aa), FASTA scores: opt: 201, E(): 2.8e-05, (23.8% identity in 189 aa overlap); etc. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. O53817|Rv0754|MTV041.28 PGRS-FAMILY PROTEIN (584 aa), FASTA scores: opt: 219, E(): 5.1e-06, (39.8% identity in 226 aa overlap). Contains signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3757202 | 3757912 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3422|lpqD
MAKRTPVRKACTVLAVLAATLLLGACGGPTQPRSITLTFIRNAQSQANADGIIDTDMPGSGLSADGKAEAQQVAHQVSRRDVDSIYSSPMAADQQTAGPLAGELGKQVEILPGLQAINAGWFNGKPESMANSTYMLAPADWLAGDVHNTIPGSISGTEFNSQFSAAVRKIYDSGHNTPVVFSQGVAIMIWTLMNARNSRDSLLTTHPLPNIGRVVITGNPVTGWRLVEWDGIRNFT
Bibliography
No article yet recorded