Gene Mb3473c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l13 rplm |
| Comments | Mb3473c, rplM, len: 147 aa. Equivalent to Rv3443c,len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). Probable rplM, 50S ribosomal protein L13, equivalent to P38014|RL13_MYCLE|RPLM|ML0364|B229_C3_232 from Mycobacterium leprae (147 aa), FASTA scores: opt: 917,E(): 7.5e-53, (91.15% identity in 147 aa overlap). Also highly similar to others e.g. Q53874|RL13_STRCO|RPLM|SC6G4.12 from Streptomyces coelicolor (147 aa), FASTA scores: opt: 668, E(): 1.1e-36,(65.5% identity in 145 aa overlap); Q9X1G5|RL13_THEMA|RPLM|TM1454 from Thermotoga maritima (149 aa), FASTA scores: opt: 536, E(): 4.4e-28, (53.65% identity in 136 aa overlap); O67722|RL13_AQUAE|RPLM|AQ_1877 from Aquifex aeolicus (144 aa), FASTA scores: opt: 529, E(): 1.2e-27, (53.2% identity in 141 aa overlap); etc. BELONGS TO THE L13P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3809649 | 3810092 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3473c|rplM
MPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRVVEKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYELKQVAQ
Bibliography
No article yet recorded
