Gene Mb3481
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE CUTINASE PRECURSOR CUT3 |
| Comments | Mb3481, cut3, len: 262 aa. Equivalent to Rv3451,len: 262 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 262 aa overlap). Probable cut3,cutinase precursor (EC 3.1.1.-), similar to others e.g. Q9KK87 from Mycobacterium avium (220 aa), FASTA scores: opt: 540, E(): 3.5e-24, (43.4% identity in 219 aa overlap); Q00298|CUTI_BOTCI|CUTA from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 214,E(): 2e-05, (31.45% identity in 210 aa overlap); Q9Y7G8 from Pyrenopeziza brassicae (203 aa), FASTA scores: opt: 203, E(): 8.5e-05, (31.05% identity in 190 aa overlap); P29292|CUTI_ASCRA from Ascochyta rabiei (223 aa), FASTA scores: opt: 155, E(): 0.054, (31.65% identity in 120 aa overlap). Similar to other proteins from Mycobacterium tuberculosis e.g. the downstream ORF O06319|Rv3452|MTCY13E12.05 HYPOTHETICAL 23.1 KDA PROTEIN (226 aa), FASTA scores: opt: 775, E(): 1e-37, (58.65% identity in 220 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c PROBABLE CUTINASE PRECURSOR (219 aa), FASTA scores: opt: 565, E(): 1.3e-25, (44.85% identity in 223 aa overlap); Q10837|CUT1_MYCTU|Rv1984c|MT2037|MTCY39.35 PROBABLE CUTINASE PRECURSOR (217 aa), FASTA scores: opt: 489, E(): 3e-21, (47.05% identity in 221 aa overlap); etc. Equivalent to AAK47897 from Mycobacterium tuberculosis strain CDC1551 (247 aa) but longer 15 aa. Contains cutinase, serine active site motif (PS00155). BELONGS TO THE CUTINASE FAMILY. Alternative start possible at 3733. Start changed since first submission (+15 aa). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3820318 | 3821106 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3481|cut3
MNNRPIRLLTSGRAGLGAGALITAVVLLIALGAVWTPVAFADGCPDAEVTFARGTGEPPGIGRVGQAFVDSLRQQTGMEIGVYPVNYAASRLQLHGGDGANDAISHIKSMASSCPNTKLVLGGYSQGATVIDIVAGVPLGSISFGSPLPAAYADNVAAVAVFGNPSNRAGGSLSSLSPLFGSKAIDLCNPTDPICHVGPGNEFSGHIDGYIPTYTTQAASFVVQRLRAGSVPHLPGSVPQLPGSVLQMPGTAAPAPESLHGR
Bibliography
No article yet recorded