Gene Mb3489c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s13 rpsm |
| Comments | Mb3489c, rpsM, len: 124 aa. Equivalent to Rv3460c,len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 124 aa overlap). Probable rpsM, 30S ribosomal protein S13, equivalent to Q9X7A1|RS13_MYCLE|RPSM|ML1960|MLCB1222.30c 30S RIBOSOMAL PROTEIN S13 from Mycobacterium leprae (124 aa), FASTA scores: opt: 762, E(): 1.5e-43, (92.75% identity in 124 aa overlap); and P45813|RS13_MYCBO|RPSM from Mycobacterium bovis (123 aa), FASTA scores: opt: 727, E(): 3e-41,(98.25% identity in 114 aa overlap). Also highly similar to others e.g. O86773|RS13_STRCO|SC6G4.05 from Streptomyces coelicolor (126 aa), FASTA scores: opt: 631,E(): 6.2e-35, (73.75% identity in 122 aa overlap); Q9RA65|RPS13 from Thermus aquaticus (subsp. thermophilus) (126 aa), FASTA scores: opt: 552, E(): 9.8e-30, (62.6% identity in 123 aa overlap); P20282|RS13_BACSU|RPSM from Bacillus subtilis (120 aa), FASTA scores: opt: 533, E(): 1.7e-28, (64245% identity in 121 aa overlap); etc. Contains ribosomal protein S13 signature (PS00646). BELONGS TO THE S13P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3827392 | 3827766 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3489c|rpsM
MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR
Bibliography
No article yet recorded
