Gene Mb3494
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | dtdp-4-dehydrorhamnose 3,5-epimerase rmlc (dtdp-4-keto-6-deoxyglucose 3,5-epimerase) (dtdp-l-rhamnose synthetase) (thymidine diphospho-4-keto-rhamnose 3,5-epimerase) |
| Comments | Mb3494, rmlC, len: 202 aa. Equivalent to Rv3465,len: 202 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 202 aa overlap). Probable rmlC (alternate gene name: rfbC), dtdp-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13), nearly identical to O33170|RMLC RMLC PROTEIN from Mycobacterium tuberculosis (203 aa), FASTA scores: opt: 1171, E(): 2.6e-71, (89.5% identity in 200 aa overlap) (previously known as rfbC). Equivalent to Q9X7A4|RMLC|ML1965 PUTATIVE DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE from Mycobacterium leprae (202 aa), FASTA scores: opt: 1072, E(): 1.1e-64,(75.4% identity in 199 aa overlap). Also highly similar to others e.g. Q9F8S7|CUMY from Streptomyces rishiriensis (198 aa), FASTA scores: opt: 671, E(): 7e-38, (51.3% identity in 193 aa overlap); Q9L6C5 from Streptomyces antibioticus (202 aa), FASTA scores: opt: 665, E(): 1.8e-37, (49.25% identity in 197 aa overlap); P29783|STRM_STRGR from Streptomyces griseus (200 aa),FASTA scores: opt: 608, E(): 1.2e-33, (49.25% identity in 201 aa overlap); Q54265|STRM from Streptomyces glaucescens (200 aa), FASTA scores: opt: 603, E(): 2.5e-33, (46.7% identity in 197 aa overlap); etc. Also highly similar to Q9S4D4|TYLJ PUTATIVE NDP-HEXOSE 3-EPIMERASE from Streptomyces fradiae (205 aa), FASTA scores: opt: 625,E(): 8.6e-35, (45.9% identity in 194 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3830530 | 3831138 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3494|rmlC
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMRGT
Bibliography
No article yet recorded