Gene Mb3504
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe31 |
| Comments | Mb3504, PE31, len: 98 aa. Equivalent to Rv3477,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 98 aa overlap). Member of the M. tuberculosis PE family, similar to O53941|Rv1791|MTV049.13 (99 aa), FASTA scores: opt: 373, E(): 4.3e-18, (64.65% identity in 99 aa overlap); MTCI364.07; MTCY21C12.10c; MTCY1A11.25c; MTC1A11.04; MTCY359.33; etc. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3840431 | 3840727 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3504|PE31
MSFTAQPEMLAAAAGELRSLGATLKVSNAAAAVPTTGVVPPAADEVSLLLATQFRTHAATYQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG
Bibliography
No article yet recorded