Gene Mb3504 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | pe family protein pe31 | 
| Comments | Mb3504, PE31, len: 98 aa. Equivalent to Rv3477,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(99.0% identity in 98 aa overlap). Member of the M. tuberculosis PE family, similar to O53941|Rv1791|MTV049.13 (99 aa), FASTA scores: opt: 373, E(): 4.3e-18, (64.65% identity in 99 aa overlap); MTCI364.07; MTCY21C12.10c; MTCY1A11.25c; MTC1A11.04; MTCY359.33; etc. | 
| Functional category | Pe/ppe | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3840431 | 3840727 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb3504|PE31
MSFTAQPEMLAAAAGELRSLGATLKVSNAAAAVPTTGVVPPAADEVSLLLATQFRTHAATYQTASAKAAVIHEQFVTTLATSASSYADTEAANAVVTG
      
    Bibliography
    No article yet recorded