Gene Mb3549
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | unknown protein |
| Comments | Mb3549, -, len: 236 aa. Equivalent to Rv3519, len: 236 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 236 aa overlap). Hypothetical unknown protein. The C-terminal end is highly similar to N-terminal end of AAK47980|MT3620 HYPOTHETICAL 7.8 KDA PROTEIN from Mycobacterium tuberculosis strain CDC1551 (73 aa), FASTA scores: opt: 279, E(): 9.4e-12, (95.65% identity in 46 aa overlap). Start uncertain. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3898765 | 3899475 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3549|Mb3549
MPVSQHTIAGTVLTMPVRIRTANLHSAMFSVPADPAQRLIDYSGLRVCEYLPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAFIHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGIEFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLGDHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
Bibliography
No article yet recorded