Gene Mb3555c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE SIDEROPHORE-BINDING PROTEIN |
| Comments | Mb3555c, -, len: 174 aa. Equivalent to Rv3525c,len: 174 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 174 aa overlap). Possible siderophore-binding protein, similar to ferripyochelin binding proteins (and related) e.g. Q9RSN5|DR2089 FERRIPYOCHELIN-BINDING PROTEIN from Deinococcus radiodurans (240 aa), FASTA scores: opt: 472, E(): 3.3e-21, (46.9% identity in 162 aa overlap); O59257|PH1591 LONG HYPOTHETICAL FERRIPYOCHELIN BINDING PROTEIN from Pyrococcus horikoshii (173 aa), FASTA scores: opt: 431,E(): 6.7e-19, (40.0% identity in 170 aa overlap); Q9V158|FBP|PAB0393 FERRIPYOCHELIN BINDING PROTEIN from Pyrococcus abyssi (173 aa), FASTA scores: opt: 429, E(): 8.9e-19, (39.4% identity in 170 aa overlap); BAB47820|MLR0180 FERRIPYOCHELIN BINDING PROTEIN-LIKE from Rhizobium loti (Mesorhizobium loti) (175 aa), FASTA scores: opt: 415, E(): 6.1e-18, (42.55% identity in 141 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3905015 | 3905539 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3555c|Mb3555c
MPLFSFEGRSPRIDPTAFVAPTATLIGDVTIEAGASVWFNAVLRGDYAPVVVREGANVQDGAVLHAPPGIPVDIGPGATVAHLCVIHGVHVGSEALIANHATVLDGAVIGARCMIAAGALVVAGTQIPAGMLVTGAPAKVKGPIEGTGAEMWVNVNPQAYRDLAARHLAGLEPM
Bibliography
No article yet recorded