Gene Mb3571c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3571c, -, len: 129 aa. Equivalent to Rv3541c,len: 129 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 129 aa overlap). Hypothetical protein,showing some similarity to Q9CBJ7|ML1909 HYPOTHETICAL PROTEIN from Mycobacterium leprae (142 aa) FASTA scores: opt: 110, E(): 1.2, (27.95% identity in 118 aa overlap); and other (see also BLASTP results) e.g. Q9L0M3|SCD82.08 HYPOTHETICAL 15.2 KDA PROTEIN from Streptomyces coelicolor (142 aa), FASTA scores: opt: 127, E(): 0.086, (27.65% identity in 123 aa overlap). Contains PS00075 Dihydrofolate reductase signature. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3923874 | 3924263 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3571c|Mb3571c MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRLGVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS
Bibliography
No article yet recorded