Gene Mb3605
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein kstr (probably tetr-family) |
| Comments | Mb3605, -, len: 199 aa. Equivalent to Rv3574, len: 199 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 199 aa overlap). Probable transcriptional regulator tetR family, similar to others e.g. Q9KXK1|SCC53.10 from Streptomyces coelicolor (250 aa) FASTA scores: opt: 492, E(): 4.8e-25, (44.8% identity in 183 aa overlap); Q9RA03|KSTR from Rhodococcus erythropolis (208 aa), FASTA scores: opt: 294, E(): 3.1e-12, (28.9% identity in 187 aa overlap); BAB54261|MLR7895 from Rhizobium loti (Mesorhizobium loti) (193 aa), FASTA scores: opt: 166, E(): 0.00062, (32.05% identity in 78 aa overlap); P17446|BETI_ECOLI|B0313 from Escherichia coli strain K12 (195 aa), FASTA scores: opt: 142, E(): 0.0034,(25. 6% identity in 168 aa overlap); etc. Equivalent to AAK48038 from Mycobacterium tuberculosis strain CDC1551 (243 aa) but shorter 44 aa. Contains possible helix-turn-helix motif from aa 37-58 (+3.70 SD). POSSIBLY BELONGS TO THE TETR/ACRR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3959699 | 3960298 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3605|kstr
MAVLAESELGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQDSA
Bibliography
No article yet recorded
