Gene Mb3623
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible heme degrading protein mhud |
Comments | Mb3623, TB11.2, len: 105 aa. Equivalent to Rv3592,len: 105 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 105 aa overlap). TB11.2, conserved hypothetical protein (see citations from 2000 below),equivalent to Q9CBI8|ML1922 HYPOTHETICAL PROTEIN from Mycobacterium leprae (105 aa) FASTA scores: opt: 591, E(): 2.5e-34, (84.6% identity in 104 aa overlap). Shows some similarity with other bacterial hypothetical proteins e.g. Q9RXN8|DR0272 from Deinococcus radiodurans (109 aa), FASTA scores: opt: 178, E(): 1e-05, (34.3% identity in 102 aa overlap); P38049|YHGC_BACSU from Bacillus subtilis (166 aa) FASTA scores: opt: 175, E(): 2.4e-05, (40.85% identity in 71 aa overlap); Q9K649|BH3883 from Bacillus halodurans (102 aa) FASTA scores: opt: 162, E(): 0.00012, (33.75% identity in 80 aa overlap); etc. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3977272 | 3977589 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3623|mhud MPVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTGKTA
Bibliography
No article yet recorded