Gene Mb3630c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3630c, -, len: 272 aa. Equivalent to Rv3600c,len: 272 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 272 aa overlap). Conserved hypothetical protein, identical to Q9CD56|ML0232 HYPOTHETICAL PROTEIN from Mycobacterium leprae (274 aa),FASTA scores: opt: 1585, E(): 1.3e-92, (90.5% identity in 274 aa overlap). Also highly similar to others e.g. Q9X8N6|SCE94.31c from Streptomyces coelicolor (265 aa) FASTA scores: opt: 878, E(): 3.9e-48, (51.5% identity in 268 aa overlap); and Q9KGH5|BH0086 from Bacillus halodurans (254 aa), FASTA scores: opt: 611, E(): 2.4e-31,(37.5% identity in 264 aa overlap). And similar to various bacterial proteins e.g. Q9F985 PUTATIVE 32 KDA REPLICATION PROTEIN from Bacillus stearothermophilus (258 aa), FASTA scores: opt: 594, E(): 2.8e-30, (37.45% identity in 267 aa overlap); P37564|YACB_BACSU from Bacillus subtilis (233 aa), FASTA scores: opt: 522, E(): 8.8e-26, (38.95% identity in 213 aa overlap); Q9RX54|DR0461 CONSERVED HYPOTHETICAL PROTEIN from Deinococcus radiodurans (262 aa), FASTA scores: opt: 503, E(): 1.5e-24, (38.45% identity in 268 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3986282 | 3987100 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3630c|Mb3630c
MLLAIDVRNTHTVVGLLSGMKEHAKVVQQWRIRTESEVTADELALTIDGLIGEDSERLTGTAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPLLVDNPKEVGADRIVNCLAAYDRFRKAAIVVDFGSSICVDVVSAKGEFLGGAIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGAVFGFAGLVDGLVGRIREDVSGFSVDHDVAIVATGHTAPLLLPELHTVDHYDQHLTLQGLRLVFERNLEVQRGRLKTAR
Bibliography
No article yet recorded
