Gene Mb3645c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 secretion-associated protein espc |
| Comments | Mb3645c, -, len: 103 aa. Equivalent to Rv3615c,len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 103 aa overlap). Conserved hypothetical protein, equivalent to Q49723|ML0406|B1620_C2_214|MLCL383 HYPOTHETICAL 11.1 KDA PROTEIN from Mycobacterium leprae (106 aa), FASTA scores: opt: 364, E(): 4.1e-18, (60.85% identity in 92 aa overlap). Also shows similarity to P96212|Rv3865|MTCY01A6.03 HYPOTHETICAL 10.6 KDA PROTEIN from Mycobacterium tuberculosis (103 aa), FASTA scores: opt: 198, E(): 6.8e-07, (36.25% identity in 102 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3997942 | 3998253 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3645c|espc
MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT
Bibliography
No article yet recorded