Gene Mb3700
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transcriptional regulatory protein crp (crp/fnr-family) |
| Comments | Mb3700, -, len: 224 aa. Equivalent to Rv3676, len: 224 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 224 aa overlap). Probable transcriptional regulator belonging to crp/fnr family,identical to Q9CB91|ML2302 PUTATIVE CRP/FNR-FAMILY TRANSCRIPTIONAL REGULATOR from Mycobacterium leprae (224 aa), FASTA scores: opt: 1408, E(): 8.8e-81, (95.95% identity in 224 aa overlap). Also highly similar to transcriptional regulators AAK58838 from Corynebacterium glutamicum (Brevibacterium flavum) (227 aa), FASTA scores: opt: 1178, E(): 1.9e-66, (79.9% identity in 224 aa overlap); and Q9XA42|SCH17.05 from Streptomyces coelicolor (224 aa), FASTA scores: opt: 869, E(): 3.4e-47, (54.45% identity in 224 aa overlap); and similar to others e.g. Q9RRX0|DR2362 from Deinococcus radiodurans (231 aa) FASTA scores: opt: 344, E(): 1.8e-14, (30.8% identity in 211 aa overlap); P29281|CRP_HAEIN from Haemophilus influenzae (224 aa), FASTA scores: opt: 330, E(): 1.3e-13, (32.25% identity in 189 aa overlap); P03020|CRP_ECOLI|CAP|CSM|B3357 from Escherichia coli strain K12 and Shigella flexneri (210 aa), FASTA scores: opt: 323, E(): 3.5e-13, (32.25% identity in 189 aa overlap); etc. Contains helix-turn-helix motif at aa 175-196 (Score 1990, +5.96 SD). BELONGS TO THE CRP/FNR FAMILY OF TRANSCRIPTIONAL REGULATORS. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4053825 | 4054499 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3700|crp
MDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYIIISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVRAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRVAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLARRAR
Bibliography
No article yet recorded