Gene Mb3719c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE CONSERVED TRANSMEMBRANE PROTEIN |
| Comments | Mb3719c, -, len: 330 aa. Equivalent to Rv3694c,len: 330 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 330 aa overlap). Possible conserved transmembrane protein, highly similar to Q9KZM4|SCE34.01c PUTATIVE INTEGRAL MEMBRANE PROTEIN from Streptomyces coelicolor (335 aa), FASTA scores: opt: 1113, E(): 2.5e-60, (51.5% identity in 334 aa overlap); and similar to Q9KEW6|BH0733 HYPOTHETICAL PROTEIN from Bacillus halodurans (355 aa), FASTA scores: opt: 381, E(): 6.1e-16,(24.15% identity in 331 aa overlap); Q9AAM9|CC0568 HYPOTHETICAL PROTEIN from Caulobacter crescentus (332 aa),FASTA scores: opt: 352, E(): 3.3e-14, (30.3% identity in 310 aa overlap); P74166|SLR1478 HYPOTHETICAL 35.4 KDA PROTEIN from Synechocystis sp. strain PCC 6803 (317 aa),FASTA scores: opt: 330, E(): 6.8e-13, (25.65% identity in 308 aa overlap); etc. C-terminal end shows similarity to O29631|AF0624|AE001061_10 CONSERVED HYPOTHETICAL PROTEIN (putative nifU protein) from Archaeoglobus fulgidus (185 aa), FASTA scores: opt: 154, E(): 0.021, (29.0% identity in 131 aa overlap). Equivalent to AAK48163 from Mycobacterium tuberculosis strain CDC1551 (395 aa) but shorter 65 aa. Also some similarity to MTCY428_20 HYPOTHETICAL 43.7 KDA PROTEIN from Mycobacterium tuberculosis. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4073469 | 4074461 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3719c|Mb3719c
MDVDAFLLTNRGTWDRLDHLIKKRHSLSGAEIDELVELYQRVSTHLSMLRSASSDQLMTGRLSSLVARARSAVTGAHAPLTRTFIRFWTVSFPVVAYRTWRWWLATAVAFFAVVVLIGFWVAGSHEVQSAIGTPTEIDELVSHDVQSYYSEHPAASFALQVWVNNSWVATTCIAMSVVLGLPIPLVLFDNAANVGLIAGLMFQAGKGDFLLGLLLPHGLLELTAVFLAAAIGMRLGWSVISAGNRPRGQVLAEQGRGVVSVAVGLVGVFLVAGLIEAVVTPSPLPTFVRIAVGIIAEAVFLSYIGYFGRRAAQAGETGDMEDAPDVVPTG
Bibliography
No article yet recorded
