Gene Mb3723A 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Possible antitoxin VapB48 | 
| Comments | Mb3723A, len: 74 aa. Equivalent to Rv3697A len: 74 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 74 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapB48,antitoxin,part of toxin-antitoxin (TA) operon with Rv3697c, see Arcus et al. 2005. Similar to others in M. tuberculosis e.g. Rv3321c, Rv0748 | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 4077587 | 4077811 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb3723A|vapB48
MRTTIDLDDDILRALKRRQREERKTLGQLASELLAQALAAEPPPNVDIRWSTADLRPRVDLDDKDAVWAILDRG
      
    Bibliography
    No article yet recorded