Gene Mb3723A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB48 |
| Comments | Mb3723A, len: 74 aa. Equivalent to Rv3697A len: 74 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 74 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapB48,antitoxin,part of toxin-antitoxin (TA) operon with Rv3697c, see Arcus et al. 2005. Similar to others in M. tuberculosis e.g. Rv3321c, Rv0748 |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4077587 | 4077811 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3723A|vapB48
MRTTIDLDDDILRALKRRQREERKTLGQLASELLAQALAAEPPPNVDIRWSTADLRPRVDLDDKDAVWAILDRG
Bibliography
No article yet recorded