Gene Mb3725
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3725, -, len: 233 aa. Equivalent to Rv3699, len: 233 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 233 aa overlap). Conserved hypothetical protein, showing similarity with hypothetical proteins e.g. Q9P3V6|SPAC1348.04 (alias Q9P3E7|SPAC750.03c or Q9P7U5|SPAC977.03) from Schizosaccharomyces pombe (Fission yeast) (145 aa), FASTA scores: opt: 188, E(): 7.5e-05, (31.65% identity in 120 aa overlap); and Q9KB70|BH2058 from Bacillus halodurans (241 aa) FASTA scores: opt: 185, E(): 0.00018, (27.8% identity in 162 aa overlap); Q9XA90|SCF43A.25c PUTATIVE METHYLTRANSFERASE from Streptomyces coelicolor (215 aa), FASTA scores: opt: 166, E(): 0.0025, (29.95% identity in 147 aa overlap); etc. Also highly similar to O06426|Rv0560c|MTCY25D10.39c HYPOTHETICAL 25.9 KDA PROTEIN from Mycobacterium tuberculosis (241 aa), FASTA scores: opt: 690, E(): 6.5e-36, (53.4% identity in 234 aa overlap); and similar to other hypothetical proteins from Mycobacterium tuberculosis e.g. P71805|Rv1377c|MTCY02B12.11c (212 aa) FASTA scores: opt: 378, E(): 1.5e-16, (35.4% identity in 192 aa overlap); P71972|Rv2675c|MTCY441.44c (250 aa) FASTA scores: opt: 297, E(): 2e-11, (31.1% identity in 193 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4079392 | 4080093 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3725|Mb3725
MTDEVMDWDSAYREQGAFEGPPPWNIGEPQPELATLIAAGKVRSDVLDAGCGYAELSLALAADGYTVVGIDLTPTAVAAATKAAEERGLTTASFVQADITEFAAYPAGSAGRFSTVIDSTLFHSLPVDSRDRYLSSVHRAAAPGASYYVLVFAKGAFPAELEVKPNEVDEDELRAAVSKYWKIDEIRPAFIHVNPVTIPPQLAGAPVEFPPYDHDEKGRVKFPAYLLTAHKAG
Bibliography
No article yet recorded
