Gene Mb3745c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3745c, -, len: 147 aa. Equivalent to Rv3718c,len: 147 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 147 aa overlap). Conserved hypothetical protein, equivalent to O69517|ML2332|MLCB2407.18 HYPOTHETICAL 15.5 KDA PROTEIN from Mycobacterium leprae (145 aa), FASTA scores: opt: 780, E(): 1.4e-44, (81.95% identity in 144 aa overlap). Also highly similar to Q9ZBJ2|SC9C7.18 CONSERVED HYPOTHETICAL PROTEIN from Streptomyces coelicolor (147 aa) FASTA scores: opt: 475, E(): 1.7e-24, (52.05% identity in 146 aa overlap); and showing some similarity to various proteins e.g. P27538|PR2_PETCR PATHOGENESIS-RELATED PROTEIN 2 from Petroselinum crispum (Parsley) (Petroselinum hortense) (158 aa); P92918|ALL2_APIGR MAJOR ALLERGEN API G 2 from Apium graveolens (Celery) (159 aa); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4099275 | 4099718 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3745c|Mb3745c
MGQVSAASTILINAEPTATLDALADYETVRPKILSPHYSEYQVLEGGKGRGTVAKWRLQATQSRVRDVQVNVDVAGHTVIEKDMNSSMVTNWTVAPAGPGSSVTVKTTWTGAGGVKGFFEKTFAPLGLKKIQAEVLSNLKTELEGDA
Bibliography
No article yet recorded
