Gene Mb3768c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | POSSIBLE OXIDOREDUCTASE |
Comments | Mb3768c, -, len: 131 aa. Equivalent to Rv3742c,len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 131 aa overlap). Possible oxidoreductase, probably combines with product of downstream ORF MTV025.090c to form a functional monooxygenase (EC 1.-.-.-), highly similar to N-terminal end of various oxidoreductases e.g. Q9A588|CC2569 MONOOXYGENASE (FLAVIN-BINDING FAMILY) from Caulobacter crescentus (498 aa), FASTA scores: opt: 170, E(): 0.00048,(47.55% identity in 103 aa overlap); Q9APW3 AROMATIC-RING HYROXYLASE from Pseudomonas aeruginosa (508 aa) FASTA scores: opt: 160, E(): 0.0022, (50.55% identity in 87 aa overlap); Q9RZT0|DRB0033 ARYLESTERASE/MONOXYGENASE from Deinococcus radiodurans (833 aa), FASTA scores: opt: 153,E(): 0.0097, (45.45% identity in 88 aa overlap); etc. Also similar to C-terminal end of Mycobacterium tuberculosis proteins (generally monooxygenases) e.g. P96223|Rv3854c|MTCY01A6.14 HYPOTHETICAL 55.3 KDA PROTEIN (489 aa), FASTA scores: opt: 140, E(): 0.044, (37.1% identity in 132 aa overlap); O53300|Rv3083|MTV013.04 MONOXYGENASE (495 aa) FASTA scores: opt: 133, E(): 0.13,(43.05% identity in 79 aa overlap); O53762|Rv0565c|MTV039.03c PUTATIVE MONOXYGENASE (486 aa),FASTA scores: opt: 110, E(): 4.1, (42.85% identity in 77 aa overlap); etc. Note similarity to MTCY01A6.14 and MTV013.04 continue in downstream ORF (MTV025.089c) after a gap of ~100 aa. |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4129144 | 4129539 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3768c|Mb3768c MHSEQSASIEHVDVLIVGAGISGTGAAYYLKTMQPAKTFAIVEARYPAIRSDSDLHTFSYEFKPWQHEKATASADAIMVHRGRSLAGGDRTLRHRRTRHHELRMVIIGSGATAVTLVPAMAQTAGAVTMPK
Bibliography
No article yet recorded