Gene Mb3773
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3773, -, len: 127 aa. Equivalent to Rv3747, len: 127 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 127 aa overlap). Hypothetical protein,highly similar to downstream ORF O69715|Rv3748|MTV025.096 CONSERVED HYPOTHETICAL PROTEIN (119 aa), FASTA scores: opt: 494, E(): 6e-27, (64.4% identity in 118 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4133018 | 4133401 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3773|Mb3773
MILTGAFLADAAAAVDNKLNVQGGVLSRFAVGPDRLARFVLVVLTQAEPDSSDRDITVEMRPPTDDEPIRLNFEAPEAAVAEFPGFAFFEIQLRLPVNGRWVLVVTGGTGAISLPVLVSDMPATIGF
Bibliography
No article yet recorded