Gene Mb3779c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3779c, -, len: 173 aa. Equivalent to Rv3753c,len: 166 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 165 aa overlap). Conserved hypothetical protein, only equivalent to Q9CB33|ML2473 HYPOTHETICAL PROTEIN from Mycobacterium leprae (159 aa) FASTA scores: opt: 920 E(): 1.4e-52,, (88.6% identity in 158 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a single base transition (t-c) leads to a longer product with a different 5' start compared to its homolog in Mycobacterium tuberculosis strain H37Rv (173 aa versus 166 aa). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4136015 | 4136536 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3779c|Mb3779c MGAQRASTQRPAADTPDGFGVAVVREEGRWRCSPMGPKALTSLRAAETELRELRSAGAVFGLLDVDDEFFVIVRPAPSGTRLLLSDATAALDYDIAAEVLDNLDAEIDPEDLEDADPFEEGDLGLLSDIGLPEAVLGVILDETDLYADEQLGRIAREMGFADQLSAVIDRLGR
Bibliography
No article yet recorded