Gene Mb3809
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3809, -, len: 178 aa. Equivalent to Rv3780, len: 178 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 178 aa overlap). Conserved hypothetical protein, equivalent to Q9CD99|ML0115 HYPOTHETICAL 19.1 KDA PROTEIN from Mycobacterium leprae (174 aa), FASTA scores: opt: 903, E(): 2.3e-48, (82.95% identity in 170 aa overlap). Also highly similar to Q9XA56|SCGD3.23c HYPOTHETICAL 19.5 KDA PROTEIN from Streptomyces coelicolor (179 aa), FASTA scores: opt: 692,E(): 1.8e-35, (65.9% identity in 170 aa overlap). Note that this putative protein is 4 aa longer at the N-terminus compared to previous annotation (in Nature 393: 537-544 (1998)). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4163284 | 4163820 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3809|Mb3809 MRKRMVIGLSTGSDDDDVEVIGGVDPRLIAVQENDSDESSLTDLVEQPAKVMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREELDRLTLPFNEDAVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLQQMRQGALPPGVGKSGQHGHGTGQYL
Bibliography
No article yet recorded