Gene Mb3827
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PUTATIVE TRANSPOSASE [FIRST PART] |
| Comments | Mb3827, -, len: 205 aa. Equivalent to 5' end of Rv3798, len: 444 aa, from Mycobacterium tuberculosis strain H37Rv, (99.5% identity in 195 aa overlap). Putative transposase for insertion sequence element IS1557, highly similar to Q60255 SIMILAR TO TRANSPOSASE OF ISAE1 FROM ALCALIGENES EUTROPHUS H1-4 (FRAGMENT) from dibenzofuran-degrading bacterium DPO360 (163 aa) FASTA scores: opt: 767, E(): 3.2e-42, (67.25% identity in 168 aa overlap); and similar to P74920 TRANSPOSASE from Thiobacillus ferrooxidans (404 aa), FASTA scores: opt: 375, E(): 1.1e-16, (27.55% identity in 439 aa overlap); Q48349 TRANSPOSASE from Alcaligenes eutrophus (Ralstonia eutropha) (408 aa), FASTA scores: opt: 324, E(): 2e-13,(3.9% identity in 369 aa overlap); Q9FDC1|TNP TRANSPOSASE from Burkholderia mallei (Pseudomonas mallei) (386 aa) FASTA scores: opt: 282, E(): 9.8e-11, (25.85% identity in 391 aa overlap); etc. C-terminal end identical to O53804|Rv0741|MTV041.15 TRANSPOSASE from Mycobacterium tuberculosis (104 aa), FASTA scores: opt: 582, E(): 1.8e-30, (85.6% identity in 104 aa overlap). BELONGS TO THE TRANSPOSASE FAMILY 12. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv3798 exists as a single gene. In Mycobacterium bovis, a frameshift due to a 11 bp deletion splits Rv3798 into 2 parts, Mb3827 and Mb3828. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4189288 | 4189905 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3827|Mb3827
MRNVRLFRALLGVDKRTVIEDIEFEEDDAGDGARVIARVRPRSAVLRRCGRCGRKASWYDRGAGLRQWRSLDWGTVEVFLEAEAPRVNCPTHGPTVVAVPWARHHAGHTYAFDDTVAWLAVACSKTAVCELMRIAWRTVGAIVARVWADTEKRIDRFANLRRIGIDEISYKRHHRYLTVVVDHDSGRLVWAAPSHPGLVLRCPGR
Bibliography
No article yet recorded