Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPOSSIBLE RESOLVASE
CommentsMb3858c, -, len: 203 aa. Equivalent to Rv3828c, len 203 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 203 aa overlap). Possible resolvase within IS1537 element, similar to others e.g. Q97X40|SSO1915 FIRST ORF IN TRANSPOSON ISC1913 from Sulfolobus solfataricus (213 aa), FASTA scores: opt: 275,E(): 1.6e-11, (30.6% identity in 196 aa overlap); Q9V1M0|PAB2076 RESOLVASE RELATED PROTEIN from Pyrococcus abyssi (212 aa), FASTA scores: opt: 254, E(): 4.2e-10,(29.95% identity in 197 aa overlap); Q9RMU7|ORFA PUTATIVE TRANSPOSASE (BELONGS TO THE MERR FAMILY OF TRANSCRIPTIONAL REGULATORS) from elicobacter pylori (Campylobacter pylori) (217 aa), FASTA scores: opt: 243, E(): 2.3e-09, (31.8% identity in 154 aa overlap); etc. Also highly similar to proteins from Mycobacterium tuberculosis e.g. O33334|Rv2792c|MTV002.57c RESOLVASE (193 aa), FASTA scores: opt: 970, E(): 1.5e-58, (79.25% identity in 193 aa overlap); O07773|Rv0605|MTCY19H5.17c PUTATIVE RESOLVASE (202 aa), FASTA scores: opt: 964, E(): 4e-58, (76.25% identity in 202 aa overlap); P95116|Rv2979c|MTCY349.08 HYPOTHETICAL 21.4 KDA PROTEIN (194 aa), FASTA scores: opt: 895, E(): 1.8e-53, (74.75% identity in 194 aa overlap); Q10831|YS86_MYCTU|Rv2886c|MT2954|MTCY274.17c HYPOTHETICAL 31.9 KDA PROTEIN (295 aa), FASTA scores: opt: 826, E(): 1.1e-48, (66.2% identity in 204 aa overlap) (similarity only at C-terminus); etc. Contains PS00397 Site-specific recombinases active site. Possible helix-turn-helix motif from aa 11-32, Score 1305 (+3.63 SD).
Functional categoryInsertion seqs and phages
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42390594239670-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3858c|Mb3858c
MSVVCCRNRWMNLAVWAERNGVAWVIAYRWFRAGLLPVPAQRVGRLILVNDPAVEESGRGRTLVYARVSSADQRSDLDRRVARVTAWATSQHLSVDKVVAEGGWALNGHRRKFFALLGDPVVTRIVVEHRDRFCWFGSEYVEAALVAQGRELVVVDLAEVDDDLVGDMTEILTSMCARLYGERAAQNGAKRALAAAVGDAEAA
      
Bibliography
No article yet recorded