Gene Mb3879
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 transcriptional regulatory protein espr |
| Comments | Mb3879, -, len: 132 aa. Equivalent to Rv3849, len: 132 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 132 aa overlap). Conserved hypothetical protein, equivalent to Q9CDC9|ML0069 HYPOTHETICAL PROTEIN from Mycobacterium leprae (132 aa) FASTA scores: opt: 724, E(): 8.7e-41, (83.95% identity in 131 aa overlap). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4259772 | 4260170 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3879|espr
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRSGNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA
Bibliography
No article yet recorded