Gene Mb3910c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx-1 secretion-associated protein espl |
| Comments | Mb3910c, -, len: 115 aa. Equivalent to Rv3880c,len: 115 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 115 aa overlap). Conserved hypothetical protein, equivalent to O33080|ML0044|MLCB628.09 HYPOTHETICAL 12.2 KDA PROTEIN from Mycobacterium leprae (113 aa), FASTA scores: opt: 397, E(): 2e-19, (56.35% identity in 110 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4296564 | 4296911 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3910c|espl
MSMDELDPHVARALTLAARFQSALDGTLNQMNNGSFRATDEAETVEVTINGHQWLTGLRIEDGLLKKLGAEAVAQRVNEALHNAQAAASAYNDAAGEQLTAALSAMSRAMNEGMA
Bibliography
No article yet recorded