Gene Mb3917c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | esx conserved component eccd2. esx-2 type vii secretion system protein. probable transmembrane protein. |
| Comments | Mb3917c, -, len: 289 aa. Equivalent to 3' end of Rv3887c, len: 509 aa, from Mycobacterium tuberculosis strain H37Rv, (99.7% identity in 288 aa overlap). Probable conserved transmembrane protein (has hydrophilic stretch from ~1-130 then very hydrophobic domain), similar to other membrane proteins and with weak similarity to known transporters, e.g. Q9CBV2|ML1539 PROBABLE MEMBRANE PROTEIN from Mycobacterium leprae (503 aa), FASTA scores: opt: 395, E(): 2.3e-16, (28.0% identity in 496 aa overlap); Q9CD35|ML2529 CONSERVED MEMBRANE PROTEIN from Mycobacterium leprae (485 aa), FASTA scores: opt: 221,E(): 6.6e-06, (24.6% identity in 423 aa overlap); Q9ADP8|2SC10A7.11 PUTATIVE INTEGRAL MEMBRANE PROTEIN from Streptomyces coelicolor (430 aa), FASTA scores: opt: 171,E(): 0.0062, (26.55% identity in 358 aa overlap); CAC44275|SCBAC17F8.03 PUTATIVE DRUG EFFLUX PROTEIN from Streptomyces coelicolor (416 aa), FASTA scores: opt: 160,E(): 0.028, (27.85% identity in 323 aa overlap); etc. Also similar to others from Mycobacterium tuberculosis e.g. O53944|Rv1795|MTV049.17 PUTATIVE MEMBRANE PROTEIN (503 aa), FASTA scores: opt: 360, E(): 2.9e-14, (26.65% identity in 514 aa overlap); etc. Equivalent to AAK48369 from Mycobacterium tuberculosis strain CDC1551 (469 aa) but longer 40 aa. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a deletion of 2406 bp leads to the loss of the NH2 part of Rv3887c, the entire Rv3888c and the COOH part of Rv3889c compared to Mycobacterium tuberculosis strain H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4306520 | 4307389 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3917c|eccd2
MAAHALIGLVVVVLGAITIGVATRKRWQTAVVTAVVTVCGILAAVAAVRMFRPVSMQVLAICVLVGLLVLIRMTPTVALWVARVRPPHFGSITGRDLFARRAGMPVDTVAPVSEADADDEDNELTGITARGTAIAASARLVNAVQVGMCVGVSLVLPAAVWGVLTPRQPWAWLALLVAGLTVGLFITQGRGFAAKYQAVALVCGASAAVCAGVLKYALDTPKGVQTGLLWPAIFVAAFAALGLAVALVVPATRFRPIIRLTVEWLEVLAMIALLPAAAALGGLFAWLRH
Bibliography
No article yet recorded
