Gene Mb3919c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | esat-6 like protein esxc (esat-6 like protein 11) |
Comments | Mb3919c, esxC, len: 124 aa. Similar to Rv3890c,len: 95 aa, from Mycobacterium tuberculosis strain H37Rv,(100% identity in 55 aa overlap). esxC, putative ESAT-6 like protein 11, equivalent to Q9K548|ES6B_MYCPA PUTATIVE ESAT-6 LIKE PROTEIN 11 (ORF3890C) from Mycobacterium paratuberculo sis (95 aa), FASTA scores: opt: 490, E(): 3.3e-26, (76.85% identity in 95 aa overlap). BELONGS TO THE ESAT6 FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a frameshift due to a single base deletion (c-*) leads to a longer product with a different COOH part compared to its homolog in Mycobacterium tuberculosis strain H37Rv (125 aa versus 95 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4307597 | 4307971 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3919c|esxC MSDQITYNPGAVSDFASDVGSRAGQLHMIYEDTASKTNALQEFFAGHGAQGFFDARRRCCRGCRGSLRRWVSMGLPPATCWTTRSEPTRPSRACSKAGRGPSEGGVHARTARLPHLLLAASWLR
Bibliography
No article yet recorded