Gene Mb3922c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe36 |
| Comments | Mb3922c, PE36, len: 77 aa. Equivalent to Rv3893c,len: 77 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 77 aa overlap). Member of the Mycobacterium tuberculosis PE family of conserved proteins, similar to other e.g. O53690|Rv0285|MTV035.13 from Mycobacterium tuberculosis (102 aa), FASTA scores: opt: 136, E(): 0.042, (35.6% identity in 73 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4309719 | 4309952 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3922c|PE36
MVWSVQPEAVLASAAAESAISAETEAAAAGAAPALLSTTPMGGDPDSAMFSAALNACGASYLGVVAEHASQRGLFAG
Bibliography
No article yet recorded