Gene Mb3934c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | putative esat-6 like protein esxe (hypothetical alanine rich protein) (esat-6 like protein 12) |
| Comments | Mb3934c, esxE, len: 90 aa. Equivalent to Rv3904c,len: 90 aa, from Mycobacterium tuberculosis strain H37Rv,(98.9% identity in 90 aa overlap). esxE, putative ESAT-6 like protein 12, hypothetical unknown ala-rich protein. BELONGS TO THE ESAT6 FAMILY. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4324398 | 4324670 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3934c|esxE
MDPTVLADAVARMAEFGRHVEELVAEIESLVTRLHVTWTGEGAAAHAEAQRHWAAGEAMMRQALAQLTAAGQSAHANYTGAVATNLGMWS
Bibliography
No article yet recorded