Gene Mb3935c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | putative esat-6 like protein esxf (hypothetical alanine and glycine rich protein) (esat-6 like protein 13) |
Comments | Mb3935c, esxF, len: 57 aa. Equivalent to Rv3905c,len: 103 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 57 aa overlap). esxF, putative ESAT-6 like protein 13, hypothetical unknown ala-, gly-rich protein, ESAT-6 like protein. BELONGS TO THE ESAT6 FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a single base transition (g-a) introducing a premature stop codon, leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (57 aa versus 103 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4324819 | 4324992 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3935c|esxF MGADDTLRVEPAVMQGFAASLDGAAEHLAVQLAELDAQVGQMLGGWRGASGSAYGSA
Bibliography
No article yet recorded