Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in biosynthesis of tryptophan (at the first step). Supposed tetramer of two components I and two components II: component I (Rv1609|trpE) catalyzes the formation of anthranilate using ammonia rather than glutamine, whereas component II (Rv0013|trpG) provides glutamine amidotransferase activity. Possibly participates in the tryptophan-dependent indole-3-acetic acid production [catalytic activity: chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate].
ProductPossible anthranilate synthase component II TrpG (glutamine amidotransferase)
CommentsRv0013, (MTCY10H4.13), len: 232 aa. Possible trpG, anthranilate synthase component II (glutamine amidotransferase). Contains PS00606 Beta-ketoacyl synthases active site; and PS00442 Glutamine amidotransferases class-I active site. Similarity to other type-1 glutamine amidotransferase domains. Note that previously known as pabA.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS1491415612+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0013|trpG
MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLLGVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQHTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA