Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein
CommentsRv0023, (MTCY10H4.23), len: 256 aa. Possible transcriptional regulator. Contains probable helix-turn helix motif from aa 19 to 40 (Score 1615, +4.69 SD).
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS2759528365+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0023|Rv0023
VSRESAGAAIRALRESRDWSLADLAAATGVSTMGLSYLERGARKPHKSTVQKVENGLGLPPGTYSRLLVAADPDAELARLIAAQPSNPTAVRRAGAVVVDRHSDTDVLEGYAEAQLDAIKSVIDRLPATTSNEYETYILSVIAQCVKAEMLAASSWRVAVNAGADSTGRLMEHLRALEATRGALLERMPTSLSARFDRACAQSSLPEAVVAALIGVGADEMWDIRNRGVIPAGALPRVRAFVDAIEASHDADEGQQ