Gene Rv0031
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Normally, required for the transposition of an insertion element. |
| Product | Possible remnant of a transposase |
| Comments | Rv0031, (MTCY10H4.31), len: 70 aa. Possible remnant of a transposase, showing partial similarity to mycobacterial transposases in a short overlap, e.g. Rv2791c|MTV002_57 (459 aa), FASTA score: (72.2% identity in 36 aa overlap); Rv2885c, Rv2978c, Rv3827c, etc. |
| Functional category | Insertion seqs and phages |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 33582 | 33794 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0031|Rv0031
LLARHFGAGRKAHSRAVATLKADIQAWHPAGIQTPKPRCESDVFARIGHTSHPSTRKSRVGPGASEAPLA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
